PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g04627.1.p
Common NameBRADI_4g04627, LOC100825980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 276aa    MW: 30863.1 Da    PI: 6.0351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g04627.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.55.5e-172168148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT +Ed+ lv++++++G g+W+  ar  g++Rt+k+c++rw++yl
  Bradi4g04627.1.p 21 RGPWTVDEDLTLVNYIAEHGEGRWNCLARGAGLKRTGKSCRLRWLNYL 68
                      89********************************************97 PP

2Myb_DNA-binding55.81.1e-1774117146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  Bradi4g04627.1.p  74 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 117
                       89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.41668IPR017930Myb domain
SuperFamilySSF466894.49E-3019115IPR009057Homeodomain-like
SMARTSM007174.2E-132070IPR001005SANT/Myb domain
PfamPF002492.5E-152168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-222275IPR009057Homeodomain-like
CDDcd001674.78E-102368No hitNo description
PROSITE profilePS5129423.8669123IPR017930Myb domain
SMARTSM007171.2E-1573121IPR001005SANT/Myb domain
PfamPF002493.8E-1674117IPR001005SANT/Myb domain
CDDcd001671.08E-1176117No hitNo description
Gene3DG3DSA:1.10.10.602.2E-2476122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MASSPSSQRI SSTVAEAEVR RGPWTVDEDL TLVNYIAEHG EGRWNCLARG AGLKRTGKSC  60
RLRWLNYLRP DVKRGNFTAD EQLLILDLHS RWGNRWSKIA QHLPGRTDNE IKNYWRTRVQ  120
KHAKQLNCDA NSSKFKDAMR YLWMPRLADH HRLHHQASDH AAMPAGQQPM GGYMESSGGM  180
ATSSSGSFAS ESYDGGFYSG SFASESYDGG FYSNACLGET MLNDDGNCWI QEAGFCAEAA  240
TDCQFQDTEL SGWVQGFSEG LAEDFWSLDD VWKMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251412120126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090181e-121BT009018.1 Triticum aestivum clone wdk3c.pk006.n12:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579302.10.0PREDICTED: transcription factor MYB108-like isoform X1
TrEMBLI1IHH60.0I1IHH6_BRADI; Uncharacterized protein
STRINGBRADI4G04627.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.12e-76myb domain protein 112